7LW2A

Crystal structure of ev-d68 2a protease n84t mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
142
structure length
142
Chain Sequence
GPGFGGVFVGSFKIINYHLATIEERQSAIYVDWQSDVLVTPIAAHGRHQIARCKCNTGVYYCRHRDKSYPVCFEGPGIQWIEQTEYYPARYQTNVLLAAGPAEAGDCGGLLVCPHGVIGLLTAGGGGIVAFTDIRNLLWLDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of EV-D68 2A protease C107A mutant
rcsb
molecule tags Hydrolase
source organism Human enterovirus d68
molecule keywords Protease 2A
total genus 28
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2021-02-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...