7LXUK

Structure of plasmodium falciparum 20s proteasome with bound mpi-5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
MDTLIGLRGNNFVVLAADTYSINSIIKLKNDDNTKFYDIHGNKCLLLGGSIGDRLQFGEFIRKNVHLYQYQNNTDMFVKSFAFFTRKNLAYYLRRNPFEVNCLIAGYDKKDGYQLYWCDYLSNMDSVNKGAHGYGAYLVSAILDKYYHENLTVDEALDIFKLCFEELKKRFLLTQINYELRIMYDNKVETQYVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteasome complex
rcsb
molecule tags Hydrolase
molecule keywords 20S proteasome alpha-1 subunit
total genus 50
structure length 195
sequence length 195
chains with identical sequence Y
ec nomenclature ec 3.4.25.1: Proteasome endopeptidase complex.
pdb deposition date 2021-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00227 Proteasome Proteasome subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...