7LZ9A

Inactive form of vanr from s. coelicolor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
220
structure length
208
Chain Sequence
GMRVLIVEDEPYLAEAIRDGLRLEAIAADIAGDGDTALELLSVNAYDIAVLDRDIPGPSGDEIAERIVASGSGMPILMLTAAGADDYLTKPFELQELALRLRALDRRRAHSRPPVREIAGLRLDPFRREVYRGGRYVALTRKQFAVLEVLVAAEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIIATVPGVGYRIDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative two-component system response regulator
publication title Structures of full-length VanR from S. coelicolor in both the inactive and activated states
doi rcsb
source organism Streptomyces coelicolor (strain atcc baa-471 / a3(2) / m145)
total genus 63
structure length 208
sequence length 220
ec nomenclature
pdb deposition date 2021-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...