7LZRA

Crystal structure of the bcl6 btb domain in complex with oicr-10256
Total Genus 45

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
DSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKAS

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TII'1 (38-41)TII1 (29-32)TI1 (63-66)S1 (34-38)TI3 (66-69)S2 (41-45)AH4 (80-91)EMPTYAH3 (55-62)AH2 (47-52)AH5 (101-112)TVIII1 (69-72)O1 (95-97)TI5 (98-101)AH1 (13-28)TI2 (64-67)S3 (71-73)TI4 (75-78)AH6 (115-127)Updating...
connected with : NaN
molecule tags Transcription/inhibitor
source organism Homo sapiens
publication title Crystal structure of the BCL6 BTB domain in complex with OICR-10256
rcsb
molecule keywords B-cell lymphoma 6 protein
total genus 45
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2021-03-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.