7M4VI

A. baumannii ribosome-eravacycline complex: 50s
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
MKTLSAKPAEVQHDWFVVDATGKTLGRLATEIARRLRGKHKTSYTPHVDTGDYIIVINAEQVQVTGNKALDKKYYRHTEFPGGLKETNFEKLVAHKPEEIFERAVKGMLPKGPLGYAMIKKMKVYAGSEHPHAAQQPQVLDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii
rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L33
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2021-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00572 Ribosomal_L13 Ribosomal protein L13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...