7MCEA

Crystal structure of the first bromodomain of human brd4 in complex with 2-{(7p)-7-(1,4-dimethyl-1h-1,2,3-triazol-5-yl)-8-fluoro-5-[(s)-(oxan-4-yl)(phenyl)methyl]-5h-pyrido[3,2-b]indol-3-yl}propan-2-ol
Total Genus 40

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
126
structure length
126
Chain Sequence
HMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH2 (96-100)TI1 (52-55)AH1 (61-76)TI2 (77-80)TIV1 (88-91)TIV2 (89-92)TI3 (90-93)AH3 (107-116)TIV3 (101-104)AH4 (122-139)EMPTY3H1 (81-83)Updating...
connected with : NaN
molecule tags Cell cycle
source organism Homo sapiens
publication title Development of BET inhibitors as potential treatments for cancer: A new carboline chemotype.
pubmed doi rcsb
molecule keywords Bromodomain-containing protein 4
total genus 40
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2021-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.