7MD71c

Crystal structure of the thermus thermophilus 70s ribosome in complex with triphenylphosphonium analog of chloramphenicol cam-c4-tpp and protein y (yfia) at 2.80a resolution
Total Genus 54

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
206
structure length
206
Chain Sequence
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTY3H1 (9-11)TIV2 (12-15)TI4 (174-177)TI5 (177-180)TII1 (11-14)S2 (52-59)TVIII1 (18-21)TI2 (25-28)3H2 (48-50)TIV4 (70-73)S3 (63-70)TIV3 (60-63)3H3 (73-75)TIV5 (75-78)AH2 (82-95)TIV6 (77-80)TVIII2 (106-109)AH4 (130-144)AH3 (113-126)TI3 (108-111)TIV9 (109-112)S7 (180-191)S6 (164-171)S5 (148-155)TIV10 (160-163)TI6 (191-194)TII2 (156-159)S8 (194-206)AH1 (28-47)S1 (20-21)TIV1 (6-9)S4 (98-105)Updating...
connected with : NaN
molecule tags Ribosome
source organism Escherichia coli (strain k12)
publication title Binding and Action of Triphenylphosphonium Analog of Chloramphenicol upon the Bacterial Ribosome
doi rcsb
molecule keywords 23S Ribosomal RNA
total genus 54
structure length 206
sequence length 206
chains with identical sequence 2c
ec nomenclature
pdb deposition date 2021-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1c PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.