7ME4A

Structure of the extracellular wnt-binding module in drosophila ror2/nrk
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
234
structure length
227
Chain Sequence
GYCAPYSGKVCKEYLTGQVWYSGGWKNEQVTTALWDELISDLTGLCREAAEKMLCAYAFPNCHMEGGRAVKAPLCFEDCQATHLQFCYNDWVLIEEKKERNMFIKSRGHFRLPNCSSLPHYNMRRPNCSYIGLTELKESEVSYDCRNGNGRFYMGTMNVSKSGIPCQRWDTQYPHKHFQPPLVFHQLLEGENYCRNAGGEEPHPWCYTVDESVRWQHCDIPMCPDYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of extracellular WNT-binding modules in ROR and RYK family receptor tyrosine kinases
rcsb
molecule tags Signaling protein
source organism Drosophila melanogaster
molecule keywords Tyrosine-protein kinase transmembrane receptor Ror2
total genus 66
structure length 227
sequence length 234
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2021-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00051 Kringle Kringle domain
A PF01392 Fz Fz domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...