7MIDC

Sub-complex of cas4-cas1-cas2 bound pam containing dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
MEHLYIVSYDIRNQRRWRRLFKTMHGFGCWLQLSVFQCRLDRIRIIKMEAAINEIVNHAEDHVLILDLGPAENVKPKVSSIGKTFDPILRQAVIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Cas4-assisted directional spacer acquisition in CRISPR-Cas.
pubmed doi rcsb
molecule keywords CRISPR-associated exonuclease Cas4/endonuclease Cas1 fusion
molecule tags Hydrolase/dna
source organism Geobacter sulfurreducens
total genus 18
structure length 95
sequence length 95
chains with identical sequence D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2021-04-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...