7MISB

Cryo-em structure of sidj-sdec-cam reaction intermediate complex
Total Genus 31

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
133
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKEEVDEMIREAGQVNYEEFVQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (7-20)S1 (27-29)TI1 (21-24)EMPTYTIV1 (59-62)AH3 (46-58)S2 (63-65)AH4 (66-77)AH5 (83-93)AH7 (120-129)TVIII2 (94-97)S3 (101-102)TI2 (96-99)AH6 (103-113)AH2 (30-40)TVIII1 (77-80)Updating...
connected with : NaN
molecule tags Transferase/ligase
source organism Legionella pneumophila
publication title Structural and mechanistic basis for protein glutamylation by the kinase fold.
pubmed doi rcsb
molecule keywords Calmodulin-dependent glutamylase SidJ
total genus 31
structure length 133
sequence length 141
ec nomenclature
pdb deposition date 2021-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.