7MJ5A

Complex of human thrombin with xc-43
Total Genus 5

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
31
structure length
31
Chain Sequence
AEVAQPKLYQRGEGGNGMEPIPEDVLNEALN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TIV1 (13-16)3H1 (17-19)EMPTYTII1 (19-22)AH1 (27-34)Updating...
connected with : NaN
molecule tags Blood clotting
publication title Identification of a substrate-like cleavage-resistant thrombin inhibitor from the saliva of the flea Xenopsylla cheopis.
pubmed doi rcsb
molecule keywords Putative secreted salivary protein
total genus 5
structure length 31
sequence length 31
chains with identical sequence N, O, P, Q, R
ec nomenclature
pdb deposition date 2021-04-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.