7MJTC

Kcsa open gate e71v mutant with barium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
91
Chain Sequence
CAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVVTATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Fab heavy chain
publication title A distinct mechanism of C-type inactivation in the Kv-like KcsA mutant E71V.
pubmed doi rcsb
source organism Synthetic construct
total genus 35
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2021-04-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...