7MK0A

Trypanosoma cruzi nucleoside diphosphate kinase 1 form a quinary multihexameric structure
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
MTSERTFIAVKPDGVQRCLVGEIIQRFEKKGYKLVALKMLQPSAEQAQQHYIDLASKPFYKDLVAYFSSGPIVGMVWEGKGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSDSVDSAKREIAFWFKPEELVNWTSHSVKQVYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray diffraction and in vivo studies reveal the quinary structure of Trypanosoma cruzi nucleoside diphosphate kinase 1: a novel helical oligomer structure.
pubmed doi rcsb
molecule keywords Nucleoside diphosphate kinase
molecule tags Transferase
source organism Trypanosoma cruzi
total genus 33
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 2.7.4.6: nucleoside-diphosphate kinase.
pdb deposition date 2021-04-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...