7MKNE

Escherichia coli rna polymerase and rapa elongation complex
Total Genus 16

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
ARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLINNQILDVRERQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (6-12)EMPTYAH2 (17-31)TI1 (13-16)AH3 (46-56)O1 (32-34)TIV1 (41-44)AH4 (61-69)Updating...
connected with : NaN
molecule tags Transcription/dna/rna
source organism Escherichia coli (strain k12)
publication title Escherichia coli RNA polymerase and RapA elongation complex
rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 16
structure length 69
sequence length 69
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2021-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.