7ML2Q

Rna polymerase ii pre-initiation complex (pic3)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
395
structure length
148
Chain Sequence
FIKRDRMRRNFLRMREYNEFPLRAIPKEDLENMRTHLLKFQSKKKINPVTDFHLPVRLHRKRKTRQLKVLDENAKKLRFEEFYPWVMEDFYNTWVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYKFTARNKYATLTIDEAEKRMDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase subunit
total genus 16
structure length 148
sequence length 395
ec nomenclature
pdb deposition date 2021-04-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...