7ML31

General transcription factor tfiih (weak binding)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
367
structure length
367
Chain Sequence
SLSKEKLLTNLKLQQSLLKGNKVLMKVFQETVINAGLPPSEFWSTRIPLLRXFALXXSQKXGPXXVXXXXXPXXXXXXXXXXNLSREKILNIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLXXXXXXXXXXXXXXXXXXLXXXXXFXXKXXXXLLHPVKKIIXLDGNIXDDPVVRGXXXXXXXXVDILKGMNRLSEKMIMXLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVITXIKINAKQAXHXXXEVKSTLPIDLLESCRMLHTTCCEFLKHFAIHQKQASTVKKLYNHLKDCIEKLNELFQDVLNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
pubmed doi rcsb
molecule tags Transcription
molecule keywords BJ4_G0050160.mRNA.1.CDS.1
total genus 106
structure length 367
sequence length 367
ec nomenclature
pdb deposition date 2021-04-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...