7MN5H

Structure of the her2/her3/nrg1b heterodimer extracellular domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
49
Chain Sequence
SHLVKCAEKEKTFCVNGGECFMVKSNPSRYLCKCPNEFTGDRCQNYVMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Receptor tyrosine-protein kinase erbB-3
publication title Structures of the active HER2/HER3 receptor complex reveal dynamics at the dimerization interface induced by binding of a single ligand
rcsb
source organism Homo sapiens
total genus 10
structure length 49
sequence length 51
ec nomenclature
pdb deposition date 2021-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...