7MNRB

Crystal structure of the znf3 of nucleoporin nup358/ranbp2 in complex with ran-gdp
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
40
structure length
40
Chain Sequence
GSMDFRSVFSTKEGQWDCSACLVQNEGSSTKCAACQNPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture of the cytoplasmic face of the nuclear pore.
pubmed doi rcsb
molecule tags Transport protein
source organism Homo sapiens
molecule keywords GTP-binding nuclear protein Ran
total genus 3
structure length 40
sequence length 40
ec nomenclature ec 2.3.2.-:
pdb deposition date 2021-05-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...