7MR4D

Cryo-em structure of recbcd-dna complex with undocked recbnuc and flexible recd
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
KLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGHVCLPLSRLENNEASHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPMILCGDRLYLNRMWCNERTVARFFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterogeneity in E. coli RecBCD Helicase-DNA binding and base pair melting.
pubmed doi rcsb
molecule keywords RecBCD enzyme subunit RecB
molecule tags Hydrolase/dna
source organism Escherichia coli (strain k12)
total genus 32
structure length 123
sequence length 123
ec nomenclature ec 3.1.11.5: Exodeoxyribonuclease V.
pdb deposition date 2021-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13538 UvrD_C_2 UvrD-like helicase C-terminal domain
D PF13604 AAA_30 AAA domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...