7MSQD

Complex between the fab arm of ab-3467 and the sars-cov-2 receptor binding domain (rbd)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
228
structure length
221
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYHWNWIRQPPGKGLEWIGYIYYSGNTNYNPSLKSRVSISTDTSKNQFSLKLSSVTAADTAVYYCVREMRRGYSGYDYWDLYAFDIWGQGTMVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability.
pubmed doi rcsb
molecule tags Viral protein/antiviral protein
source organism Severe acute respiratory syndrome coronavirus 2
molecule keywords Spike protein S1
total genus 46
structure length 221
sequence length 228
chains with identical sequence H
ec nomenclature
pdb deposition date 2021-05-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...