7MWNB

An engineered pyl2-based win 55,212-2 synthetic cannabinoid sensor with a stabilized hab1 variant
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
320
structure length
294
Chain Sequence
SIPLWGTVSIQGNASEMEAAFAVVPHFLKLPIKMLMTHLTGHFFGVYDGHGGSKVADYCRDRLHEALAEEIERIRQVQWKKVFTNCFLTVDGEIEGKIGRAVDKVLEAVASETVGSTAVVALVCSSHIVVANCGDSRAVLFRGKEAIPLSVDHKPDREDEYARIEAAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSEEDECLILASDGLWDVMSNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSKLALQKGSKDNISIIVIDLKAQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid biosensor development using plant hormone receptors as reprogrammable scaffolds.
pubmed doi rcsb
molecule keywords Abscisic acid receptor PYL2
molecule tags Plant protein
source organism Arabidopsis thaliana
total genus 91
structure length 294
sequence length 320
ec nomenclature ec 3.1.3.16: protein-serine/threonine phosphatase.
pdb deposition date 2021-05-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...