7MY6A

Se-crte c-term his-tag with ipp added
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
303
structure length
287
Chain Sequence
VASSSLRFDLKSYLKERQRQVEAALNAILPPQDPPLIYESMRYSLLAEGKRLRPILCLASCELAGGTAAIALPTACALEMVHTMSLIHDDLPSMDNDDFRRGRPTNHKVYGEDIAILAGDALLTYAFEAIARHTPEVPADRVLKVIAALARAVGAEGLVGGQVVDLQSEGRDDVNLETLHYIHTHKTGALLEVSVVSGAILAGASEELQEQLRTYAQKIGLAFQVIDDILDITAKATYPSLLGLDASREYADQLITEAKAAIAAFGAEADPLRAIADYITARKHLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular characterization of cyanobacterial short-chain prenyltransferases and discovery of a novel GGPP phosphatase.
pubmed doi rcsb
molecule keywords Farnesyl-diphosphate synthase
molecule tags Transferase
source organism Synechococcus elongatus pcc 7942 = fachb-805
total genus 118
structure length 287
sequence length 303
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2021-05-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...