7N11A

Crystal structure of the m. abscessus leurs editing domain in complex with epetraborole-amp adduct
Total Genus 48
2040608010012014016018001020304050
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
195
Chain Sequence
QGASVLFGAPGAGDIEVFTTRPDTLFGATYMVLAPEHPLVDQLAADVWPQDTDPRWTGGQDSPRAAIEQYRRSIAAKSDLERQENKEKTGVFTGAYATNPVSGKPVPVFIADYVLLGYGTGAIMAVPGHDQRDWDFANTFGLPVQEVISGGDVTKAAYTGDGVLVNSDYLDGLDIEAAKVEVTRRLVKDGRGESR

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/ligase inhibitor
source organism Mycobacteroides abscessus
publication title Efficacy of epetraborole against Mycobacterium abscessus is increased with norvaline
rcsb
molecule keywords Leucine--tRNA ligase
total genus 48
structure length 195
sequence length 195
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2021-05-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.