7N6SA

Crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e in complex with 2'-deoxyuridine 5'-monophoephate (dump)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
135
structure length
135
Chain Sequence
SMTIIEVKIKKLENFLGNLPEYATEHSAGMDLVAANEQSITIKVGSIQLIPTGIAIALPESFEAQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVLLINLGNKDFIIEKGMRIAQMIIAKYERVLWAETSILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from Rickettsia prowazekii str. Madrid E in complex with 2'-deoxyuridine 5'-monophoephate (dUMP)
rcsb
molecule keywords Deoxyuridine 5'-triphosphate nucleotidohydrolase
molecule tags Hydrolase
source organism Rickettsia prowazekii (strain madrid e)
total genus 18
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.1.23: dUTP diphosphatase.
pdb deposition date 2021-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00692 dUTPase dUTPase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...