7N7XAAA

Crystal structure of bcx7353(orladeyo) in complex with human plasma kallikrein serine protease domain at 2.1 angstrom resolution
Total Genus 49

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
236
structure length
229
Chain Sequence
IVGGTESSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILELSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLEYTEFQKPISLPIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (5-6)TII2 (8-11)S2 (15-21)TIV1 (10-13)TVIII3 (107-110)S3 (25-35)TI1 (12-15)TIV2 (21-24)S5 (55-59)TI2 (35-38)S7 (95-99)TVIII2 (99-102)3H1 (43-46)TIV5 (90-93)S6 (74-81)3H2 (64-66)TI4 (68-71)TI5 (82-85)S9 (223-227)TI6 (86-89)TIV8 (213-216)TI7 (106-109)TIV6 (201-204)TIV7 (211-214)S10 (229-230)S4 (38-41)TI3 (46-49)TII1 (1-4)S8 (204-208)Updating...
connected with : NaN
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Berotralstat (BCX7353): Structure-Guided Design of a Potent, Selective, and Oral Plasma Kallikrein Inhibitor to Prevent Attacks of Hereditary Angioedema (HAE).
pubmed doi rcsb
molecule keywords Plasma kallikrein light chain
total genus 49
structure length 229
sequence length 236
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2021-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AAA PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.