7N8NA

Melbournevirus nucleosome like particle
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
197
structure length
197
Chain Sequence
DHVSVGETQIPKASTQHLLRKAGSLSAAGDTEVPIRGFVHMKLHKLVQKSLLAMQLAKRKTIMKSDVKKAAELMHLPVFAIPTKDSGAKGSVFLSCRQKGAGSAGTGSETNSQEVRSQMKSTCLIIPKERFRTMAKEISKKEGHDVHIAEAALDMLQVIVESCTVRLLEKALVITYSGKRTRVTSKDIETAFMLEHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Virus-encoded histone doublets are essential and form nucleosome-like structures.
pubmed doi rcsb
molecule keywords Histone H4-H3 doublet
molecule tags Dna binding protein/dna
source organism Melbournevirus
total genus 57
structure length 197
sequence length 197
chains with identical sequence C
ec nomenclature
pdb deposition date 2021-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...