7ND0C

Lateral-open conformation of the wild-type bam complex (bamabcde) bound to a bactericidal fab fragment
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
61
structure length
61
Chain Sequence
CSSDSRYKRQVSGDEAYLEAAPLAELHAPAGMILPVTSGDYAIPVTNGSGAVGKALDIRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of membrane destabilisation and protein dynamics in BAM catalysed OMP folding
rcsb
molecule keywords Outer membrane protein assembly factor BamA
molecule tags Membrane protein
source organism Escherichia coli k-12
total genus 1
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2021-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06804 Lipoprotein_18 NlpB/DapX lipoprotein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...