7ND0H

Lateral-open conformation of the wild-type bam complex (bamabcde) bound to a bactericidal fab fragment
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
221
structure length
221
Chain Sequence
QLVESGGGLVQPGRSLKLSCVASRFTFSNYGMNWIRQTPGKGLEWVAYIGSTSSHIYYAETVKGRFTISRDNAKNTLYLQMTGLRSEDTALYYCVGHVRKLGAFFDYWGQGAMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (4-7)S3 (18-24)S2 (11-12)TII1 (13-16)S8 (78-83)TI5 (74-77)TI4 (73-76)TIV1 (24-27)S9 (92-99)S4 (34-40)S5 (44-51)S6 (58-60)TVIII1 (55-58)TIV3 (52-55)S7 (68-73)TI1 (61-64)TI2 (62-65)TIV4 (64-67)3H1 (88-90)S13 (142-152)TI7 (178-181)S17 (201-207)S14 (157-161)TII3 (195-198)S16 (183-192)TVIII3 (164-167)TIV10 (167-170)S15 (170-177)S18 (212-218)TIV11 (196-199)S11 (114-118)TIV2 (29-32)TII2 (40-43)TIV5 (83-86)S10 (107-110)TIV7 (101-104)S12 (127-131)TIV9 (138-141)3H3 (193-195)3H2 (162-164)3H4 (208-210)Updating...
connected with : NaN
molecule tags Membrane protein
source organism Escherichia coli k-12
publication title The role of membrane destabilisation and protein dynamics in BAM catalysed OMP folding
rcsb
molecule keywords Outer membrane protein assembly factor BamA
total genus 36
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2021-01-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.