7NILF

1918 h1n1 viral influenza polymerase heterotrimer with nb8190 core
Total Genus 24

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
100
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASYTMGWFRQAPGKEREFVTAIANYADSVKGRFTISRDNAKNTAYLQMNSLKPEDTAVYYCAGKTDYWGQGTQVTVS

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (4-7)TIV3 (83-86)S9 (92-99)S2 (10-12)TIV4 (98-111)TII1 (13-16)EMPTYS7 (68-73)S3 (18-24)TII2 (64-67)TI3 (62-65)S6 (59-60)S4 (33-39)S8 (78-83)TI1 (40-43)S5 (46-51)TIV1 (50-59)TI2 (61-64)3H1 (88-90)TI4 (73-76)Updating...
connected with : NaN
molecule tags Viral protein
source organism Influenza a virus (a/brevig mission/1/1918(h1n1))
publication title Mapping inhibitory sites on the RNA polymerase of the 1918 pandemic influenza virus using nanobodies.
pubmed doi rcsb
molecule keywords Polymerase acidic protein
total genus 24
structure length 100
sequence length 122
ec nomenclature
pdb deposition date 2021-02-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.