7NL2A

Structure of xyn11 from pseudothermotoga thermarum
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
335
structure length
335
Chain Sequence
QIPSLKDVFLQDFKIGVALPVRVFSNSMDVELITKHFNSMTAENEMKPESILRRDASGKIYYDFTVADRYIEFAQKHGMVVRGHTLVWHSQTPEWFFKDEKGNLLSREAMIERMREYIHTVVGRYRGKVYAWDVVNEAVDENQPDGLRRSLWYQVIGPDYIELAFKFAHEADPDALLFYNDYNEFFPKKRDIIFKLVKEMREKGVPIHGIGMQQHLTLADNVGWIDIAIQKFKTISGIQIHITELDVSVYKSRSPSIIYQTPPLEVLKEQAEFYRKLFEIYRKHTDVITNVTFWGLKDDYSWLRFFFGRRNDWPLLFDENYQPKPAFWSVIESVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phylogenetic, functional and structural characterization of a GH10 xylanase active at extreme conditions of temperature and alkalinity
doi rcsb
molecule keywords Beta-xylanase
molecule tags Hydrolase
source organism Pseudothermotoga thermarum dsm 5069
total genus 136
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2021-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...