7NP7P1

Structure of an intact esx-5 inner membrane complex, composite c1 model
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
538
structure length
444
Chain Sequence
ISPPTIDPGALPPDGPPGPLAPMKQNAYCTEVGVLPGTDFQLQPKYMEMLNLNEAWQFGRGDGVKVAVIDTGVTPHPRLPRLIPGGDYVMAGGDGLSDCDAHGTLVASMIAAVPANGAVPLPSVPRRPVTIPPDAFSGIAPGVEIISIRQSSQAFGLKDPYTGDEDPQTAQKIDNVETMARAIVHAANMGASVINISDVMCMSARNVIDQRALGAAVHYAAVDKDAVIVAAAGDGSKKDCKQNPIFDPLQPDDPRAWNAVTTVVTPSWFHDYVLTVGAVDANGQPLSKMSIAGPWVSISAPGTDVVGLSPRDDGLINAIDGPDNSLLVPAGTSFSAAIVSGVAALVRAKFPELSAYQIINRLIHTARPPARGVDNQVGYGVVDPVAALTWDVPKGPAEPPKQLSAPLVVPQPPAPRDMVPIWVAAGGLAGALLIGGAVFGTATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of a mycobacterial type VII secretion system.
pubmed doi rcsb
molecule tags Membrane protein
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule keywords ESX-5 secretion system ATPase EccB5
total genus 96
structure length 444
sequence length 538
chains with identical sequence P2, P3
ec nomenclature ec 3.4.21.-:
pdb deposition date 2021-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P1 PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...