7NX0D

Extracellular tg and egf-like domains of alk
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
120
Chain Sequence
QLQESGGGLVQTGGSLRLSCTASGRLAMGWFRQAPGKEREFVAAISWSTGITDYSDSVKGRFTMSRDNAKSTVYLQMNSLKPEDTAVYYCAAVDRHSPGSAWYNRNFGSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of cytokine-mediated activation of ALK family receptors.
pubmed doi rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Leukocyte tyrosine kinase receptor
total genus 28
structure length 120
sequence length 124
chains with identical sequence E
ec nomenclature
pdb deposition date 2021-03-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...