7O19AN

Cryo-em structure of an escherichia coli tnac-ribosome complex stalled in response to l-tryptophan
Total Genus 17

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNAASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (3-17)EMPTYTI3 (57-60)TIV2 (19-22)TIV1 (17-20)TIV3 (20-23)TI1 (34-37)TIV6 (52-55)TI2 (56-59)TIV7 (64-67)TI6 (75-78)S1 (73-74)TI5 (74-77)S2 (79-80)AH2 (24-29)AH4 (81-90)TVIII1 (91-94)AH3 (39-49)Updating...
connected with : NaN
molecule tags Translation
publication title Structural basis for the tryptophan sensitivity of TnaC-mediated ribosome stalling.
pubmed doi rcsb
molecule keywords Ribosomal RNA 16S
total genus 17
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2021-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AN PF00253 Ribosomal_S14 Ribosomal protein S14p/S29e
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.