7O6XA

Tankyrase 2 in complex with an inhibitor (om-153)
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
46
structure length
38
Chain Sequence
MAHSPPGHHSVTGRAEYVIYRGEQAYPEYLITYQIMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development of a 1,2,4-Triazole-Based Lead Tankyrase Inhibitor: Part II.
pubmed doi rcsb
molecule tags Transferase
source organism Homo sapiens
molecule keywords Poly [ADP-ribose] polymerase tankyrase-2
total genus 1
structure length 38
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.4.2.-:
pdb deposition date 2021-04-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...