7O7HA

Crystal structure of rsegfp2 mutant v151l in the non-fluorescent off-state determined by synchrotron radiation at 100k
Total Genus 68

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
236
Chain Sequence
HHHHTDPMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVLCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNLYIMADKQKNGIKSNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (0-8)AH2 (84-88)S1 (13-23)S3 (42-49)S2 (26-37)S6 (119-129)TIV4 (135-138)3H2 (58-64)TI1 (49-52)EMPTYS11 (218-228)3H3 (70-72)S4 (93-101)S9 (177-188)3H4 (77-82)TVIa1 (88-91)S10 (200-209)TIV2 (89-92)TIV3 (115-118)S5 (106-116)TII1 (101-104)TI2 (132-135)TI3 (136-139)O1 (143-145)TI4 (137-140)S7 (149-156)TI5 (172-175)TI6 (211-214)S8 (161-171)3H5 (157-159)3H1 (38-40)TIV1 (22-25)Updating...
connected with : NaN
molecule tags Fluorescent protein
source organism Aequorea victoria
publication title Rational Control of Off-State Heterogeneity in a Photoswitchable Fluorescent Protein Provides Switching Contrast Enhancement.
pubmed doi rcsb
molecule keywords Green fluorescent protein
total genus 68
structure length 236
sequence length 237
ec nomenclature
pdb deposition date 2021-04-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.