7OA5A

Ruva complexed to a holliday junction.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
181
Chain Sequence
b'MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLYGFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGAERIVLELRDKVGPAVRGSVVEALVGLGFAAKQAEEATDQVLDGVATSSALRAALSLLGKTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase RuvA
publication title Crystal structure of an octameric RuvA-Holliday junction complex
rcsb
source organism Mycobacterium leprae (strain tn)
molecule tags Dna binding protein
total genus 44
structure length 181
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2021-04-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...