7ODMAAA

Amgstf1 y118s variant
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
215
structure length
215
Chain Sequence
APVKVFGPAMSTNVARVTLCLEEVGAEYEVVNIDFNTMEHKSPEHLARNPFGQIPAFQDGDLLLWESRAISKYVLRKYKTDEVDLLRESNLEEAAMVDVWTEVDAHTYNPALSPIVSQCLFNPMMRGLPTDEKVVAESLEKLKKVLEVYEARLSKHSYLAGDFVSFADLNHFPYTFYFMATPHAALFDSYPHVKAWWDRLMARPAVKKIAATMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flavonoid-based inhibitors of the Phi-class glutathione transferase from black-grass to combat multiple herbicide resistance.
pubmed doi rcsb
molecule keywords Glutathione transferase
molecule tags Transferase
source organism Alopecurus myosuroides
total genus 68
structure length 215
sequence length 215
ec nomenclature ec 2.5.1.18: glutathione transferase.
pdb deposition date 2021-04-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...