7ODRX

State a of the human mitoribosomal large subunit assembly intermediate
Total Genus 57

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
244
structure length
244
Chain Sequence
PLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (11-16)3H2 (20-23)AH9 (208-219)AH2 (26-33)TII1 (203-206)TI'1 (80-83)TIV1 (40-43)EMPTYS1 (50-53)S2 (58-61)TI2 (54-57)TI1 (53-56)S3 (69-70)3H3 (73-76)AH6 (156-171)S4 (78-79)AH3 (129-138)S10 (126-128)S7 (109-110)S8 (113-116)S9 (121-124)TI5 (117-120)AH4 (141-147)AH7 (181-191)TI4 (116-119)AH5 (150-153)TI6 (173-176)TI7 (177-180)3H5 (192-194)AH8 (198-202)3H1 (8-10)TVIII1 (4-7)3H4 (92-94)S5 (85-91)TI3 (95-98)AH10 (226-244)S6 (100-105)Updating...
connected with : NaN
molecule tags Ribosome
publication title Stepwise maturation of the peptidyl transferase region of human mitoribosomes
doi rcsb
molecule keywords Mitochondrial assembly of ribosomal large subunit protein 1
total genus 57
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2021-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00830 Ribosomal_L28 Ribosomal L28 family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...