7ODS3

State b of the human mitoribosomal large subunit assembly intermediate
Total Genus 17

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
LTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKRLREFVFCNKTQSKLLDKMTTSFWKRRNWYVDDPYQKYHDRTNLKV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
publication title Stepwise maturation of the peptidyl transferase region of human mitoribosomes
doi rcsb
molecule keywords Mitochondrial assembly of ribosomal large subunit protein 1
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2021-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.