7ODWA

Model of haliangium ochraceum encapsulin from icosahedral single particle reconstruction
Total Genus 62

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
265
structure length
265
Chain Sequence
DLLKRHLAPIVPDAWSAIDEEAKEIFQGHLAGRKLVDFRGPFGWEYAAVNTGELRPIDDTPEDVDMKLRQVQPLAEVRVPFTLDVTELDSVARGATNPDLDDVARAAERMVEAEDSAIFHGWAQAGIKGIVDSTPHEALAVASVSDFPRAVLSAADTLRKAGVTGPYALVLGPKAYDDLFAATQDGYPVAKQVQRLVVDGPLVRANALAGALVMSMRGGDYELTVGQDLSIGYAFHDRSKVELFVAESFTFRVLEPGAAVHLRYA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI1 (2-5)AH1 (13-29)S11 (222-237)S1 (38-40)TI2 (44-47)S3 (68-74)S2 (49-57)TI4 (123-126)S12 (241-254)S4 (76-85)AH2 (86-94)TIV2 (96-99)AH3 (101-121)TI8 (206-209)TI6 (131-134)TVIII2 (254-257)TI10 (256-259)AH4 (148-162)S6 (168-172)S9 (204-205)AH5 (174-182)TIV5 (209-212)S8 (188-189)S7 (184-185)TIV4 (184-187)AH6 (190-197)S13 (260-264)S10 (212-216)TI9 (238-241)3H1 (6-8)3H2 (33-35)TIV3 (130-133)TI5 (124-127)3H3 (145-147)Updating...
connected with : NaN
molecule tags Virus like particle
source organism Haliangium ochraceum (strain dsm 14365 / jcm 11303 / smp-2)
publication title Pore dynamics and asymmetric cargo loading in an encapsulin nanocompartment.
pubmed doi rcsb
molecule keywords Linocin_M18 bacteriocin protein
total genus 62
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2021-04-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.