7OE2A

Model of closed pentamer of the haliangium ochraceum encapsulin from symmetry expansion of icosahedral single particle reconstruction
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
266
structure length
266
Chain Sequence
MDLLKRHLAPIVPDAWSAIDEEAKEIFQGHLAGRKLVDFRGPFGWEYAAVNTGELRPIDDTPEDVDMKLRQVQPLAEVRVPFTLDVTELDSVARGATNPDLDDVARAAERMVEAEDSAIFHGWAQAGIKGIVDSTPHEALAVASVSDFPRAVLSAADTLRKAGVTGPYALVLGPKAYDDLFAATQDGYPVAKQVQRLVVDGPLVRANALAGALVMSMRGGDYELTVGQDLSIGYAFHDRSKVELFVAESFTFRVLEPGAAVHLRYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pore dynamics and asymmetric cargo loading in an encapsulin nanocompartment.
pubmed doi rcsb
molecule keywords Linocin_M18 bacteriocin protein
molecule tags Virus like particle
source organism Haliangium ochraceum (strain dsm 14365 / jcm 11303 / smp-2)
total genus 72
structure length 266
sequence length 266
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2021-05-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...