7OF5L

Structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 and gtpbp5 (dataset2).
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
115
structure length
115
Chain Sequence
AIQKMTRVRVVDNSALGNSPYHRAPRCIHVYKKNGVGKVGDQILLAIKGQKKKALIVGHCMPGPRMTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLRKREGEYSKVLAIAQNFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling
rcsb
molecule keywords 39S ribosomal protein L32, mitochondrial
molecule tags Ribosome
total genus 20
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2021-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...