7OHSD

Nog1-tap associated immature ribosomal particle population f from s. cerevisiae
Total Genus 131
50100150200250300350400020406080100120
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
448
structure length
437
Chain Sequence
EKFEELKLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELLHSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFINVLEQGYVVCDSDKRFLLLFSFLKRNQKKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPNELGFLRYLKASKVPLNEYEFPENKIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQAYASHSLKTVYQIDKLDLAKVAKSYGFPVPPKVNITI
50100150200250300350400400300200100
020406080100120Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTII2 (182-185)3H1 (44-46)AH8 (206-216)TIV3 (187-190)AH2 (67-78)O1 (61-63)AH3 (92-107)TIV1 (87-90)TIV2 (89-92)3H2 (111-113)S1 (117-120)S2 (145-148)AH5 (154-163)TVIII1 (165-168)S8 (317-319)S4 (192-196)S3 (167-170)AH6 (172-181)AH7 (198-204)TVIII2 (190-193)S9 (341-346)TI1 (219-222)TI5 (418-421)S5 (223-227)TVIII4 (367-370)TIV5 (311-314)TVIII3 (228-231)AH9 (233-242)TII3 (287-290)TIV4 (244-247)TI3 (395-398)AH10 (274-287)O2 (265-267)S6 (267-270)S7 (291-296)AH11 (299-311)TI2 (320-323)AH12 (325-338)AH13 (347-352)O4 (385-387)S11 (389-394)TI4 (396-399)AH15 (400-408)TVIII5 (419-422)AH16 (425-435)AH1 (51-60)TII1 (149-152)AH4 (124-139)S10 (360-363)AH14 (370-383)O5 (413-415)Updating...
connected with : NaN
molecule tags Ribosome
publication title Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
rcsb
molecule keywords 25S rRNA
total genus 131
structure length 437
sequence length 448
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2021-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00270 DEAD DEAD/DEAH box helicase
D PF00271 Helicase_C Helicase conserved C-terminal domain
D PF13959 DUF4217 Domain of unknown function (DUF4217)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.