7OSAuL14

Pre-translocation complex of 80 s.cerevisiae ribosome with eef2 and ligands
Total Genus 25

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
132
structure length
132
Chain Sequence
AQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS4 (51-52)O1 (6-8)TII3 (45-48)S1 (17-18)S2 (21-25)TI2 (104-107)TII4 (53-56)S3 (33-39)TII2 (39-42)S6 (72-80)TIV1 (69-72)3H1 (67-69)S8 (92-93)TI1 (87-90)S9 (99-102)AH1 (120-125)TII1 (18-21)S7 (85-86)AH2 (127-131)S5 (56-62)TVIII1 (62-65)Updating...
connected with : NaN
publication title Accuracy mechanism of eukaryotic ribosome translocation.
pubmed doi rcsb
molecule keywords 25S rRNA
molecule tags Ribosome
total genus 25
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2021-06-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.