7OSAuS3

Pre-translocation complex of 80 s.cerevisiae ribosome with eef2 and ligands
Total Genus 40
204060801001201401601802000510152025303540
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
214
Chain Sequence
ALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTGPKALPDAVTIIEPKEEEP
2040608010012014016018020020015010050
010203040Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (7-29)S1 (34-41)AH2 (65-77)3H1 (30-32)S2 (46-52)3H2 (94-96)EMPTYTIV1 (42-45)TII1 (80-83)S3 (84-85)S4 (88-90)TVIII1 (52-55)TIV2 (54-57)TIV6 (59-62)TIV7 (60-63)AH3 (98-110)TIV9 (91-94)S7 (168-177)S6 (148-154)S5 (133-140)AH5 (162-167)S8 (180-189)TI1 (202-205)TIV8 (61-64)3H3 (192-194)TIV12 (195-198)AH4 (115-129)Updating...
connected with : NaN
publication title Accuracy mechanism of eukaryotic ribosome translocation.
pubmed doi rcsb
molecule keywords 25S rRNA
molecule tags Ribosome
total genus 40
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2021-06-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.