7OVAAAA

Crystal structure of an aa9 lpmo
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
229
structure length
229
Chain Sequence
HGFVSGAVVDGKYYTGYLVNQYPYMSSPPESIGWSETATDLGFVDGSGYSSGDIICHKSAKNGAISAEIKAGGKVEFQWTEWPESHHGPVITYMANCNGDCASVDKTSLEFFKIDESGLISDSNVPGTWASDNLIANNNSWTVTVPSSIAAGNYVMRHEIIALHSAGNQNGAQNYPQCINLKVTGGGSDKPAGTLGTALYKNTDAGILVNIYQSLSSYDIPGPALYSGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an AA9 LPMO
rcsb
molecule keywords Endoglucanase, putative
molecule tags Oxidoreductase
source organism Neosartorya fischeri (strain atcc 1020 / dsm 3700 / cbs 544.65 / fgsc a1164 / jcm 1740 / nrrl 181 / wb 181)
total genus 57
structure length 229
sequence length 229
chains with identical sequence BBB, CCC, DDD
ec nomenclature ec 3.2.1.4: cellulase.
pdb deposition date 2021-06-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...