7P20A

High resolution structure of the juniperus ashei allergen - jun a 3
Total Genus 55
2040608010012014016018020001020304050
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
203
structure length
203
Chain Sequence
VVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQTGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDVSLVDGFNIPLAIQPTNAQCTAPACKADINAVCPSELKVDGGCNSACNVFKTDQYCCRNAYVDNCPATQYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCPHHH
2040608010012014016018020020015010050
01020304050Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (27-33)EMPTYS6 (84-88)TI1 (62-65)TIV1 (43-46)S4 (55-61)S5 (67-78)TI2 (79-82)TVIII2 (94-97)TI'1 (91-94)TVIII1 (86-89)TIV3 (87-90)TIV4 (90-93)TIV5 (112-115)TIV7 (134-137)S7 (107-112)S8 (116-121)AH2 (172-175)TI3 (122-125)S9 (130-134)TI4 (136-139)S10 (143-144)3H1 (148-150)TII2 (158-161)3H2 (154-156)S11 (157-158)3H3 (178-180)AH1 (165-169)TI5 (180-183)S2 (39-44)S3 (47-51)S12 (161-162)AH3 (188-196)TII1 (52-55)TI6 (197-200)Updating...
connected with : NaN
molecule tags Allergen
source organism Juniperus ashei
publication title Crystal structure of the allergen Jun a 3 the Thaumatin-like protein of Juniperus ashei
rcsb
molecule keywords Pathogenesis-related 5 protein Jun a 3.0101
total genus 55
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2021-07-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.