7P2FA

Green-type copper-nitrite reductase from sinorhizobium meliloti 2011
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
329
structure length
329
Chain Sequence
SLPRVKVDLVKPPFVHAHTQKAEGGPKVVEFTLTIEEKKIVIDEQGTELHAMTFNGSVPGPLMVVHQDDYVELTLINPDTNTLQHNIDFHSATGALGGGALTVVNPGDTTVLRFKASKAGVFVYHCAPPGMVPWHVTSGMNGAIMVLPREGLTDGKGNSITYDKVYYVGEQDFYVPRDANGKFKKYESVGEAYADTLEVMRTLTPSHIVFNGAVGALTGDSALKAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFRNAPDVDQETWFIPGGTAGAAFYTFEQPGIYAYVNHNLIEAFELGAAAHFAVTGDWNDDLMTSVRAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Copper nitrite reductase from Sinorhizobium meliloti 2011: Crystal structure and interaction with the physiological versus a nonmetabolically related cupredoxin-like mediator.
pubmed doi rcsb
molecule keywords Copper-containing nitrite reductase
molecule tags Metal binding protein
source organism Sinorhizobium meliloti 2011
total genus 86
structure length 329
sequence length 329
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2021-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...