7P2YA

F1fo-atp synthase from acinetobacter baumannii (state 1)
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
509
structure length
509
Chain Sequence
QLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGLADAMYGEMIEFDGGLFGMALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPELLGRVVDALGNPIDGKGPIDAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPVGRGQRELIIGDRQTGKTAMAIDAIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGAMAYTTVVAAAAADPAAMQYLAPYSGCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERASRVSAEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMADVEVKKIVDFDAALIAYFRSEYAPLMKQIDETGDYNKDIEAAIKAGIESFKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ATP synthase from ESKAPE pathogen Acinetobacter baumannii.
pubmed doi rcsb
molecule keywords ATP synthase subunit alpha
molecule tags Membrane protein
total genus 142
structure length 509
sequence length 509
chains with identical sequence B, C
ec nomenclature ec 7.1.2.2: H(+)-transporting two-sector ATPase.
pdb deposition date 2021-07-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...