7P3Nd

F1fo-atp synthase from acinetobacter baumannii (state 2)
Total Genus 56

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
174
structure length
174
Chain Sequence
ELLTLARPYAKAAFAYASEQGATDNWSNALQVLSAAVQDEAFSAYLNRPELTPAEQVKLFAKVLGEDQSQAVSNFLTLLADNDRLVLLPEIAAEYEQLKSQNNNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTVSVEVKPELIAGVVIRAGDQVIDDSALNKLEKMRTRL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (4-22)AH5 (72-84)AH2 (24-40)EMPTYAH3 (42-49)TIV1 (50-53)AH4 (55-66)TIV4 (86-89)S3 (152-156)S1 (110-114)S2 (140-141)S4 (159-161)TIV7 (155-158)AH8 (165-175)TIV2 (66-69)TIV3 (67-70)AH6 (89-105)TIV5 (145-148)TVIII1 (135-138)AH7 (120-133)Updating...
connected with : NaN
molecule tags Membrane protein
publication title Structure of ATP synthase from ESKAPE pathogen Acinetobacter baumannii.
pubmed doi rcsb
molecule keywords ATP synthase subunit alpha
total genus 56
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2021-07-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.